PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G2055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 236aa    MW: 26214.1 Da    PI: 7.1683
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G2055genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-19954147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W +eEde l ++v+++G+++W++I+r ++ gR++k+c++rw + 
      Gh_D02G2055  9 KGPWGPEEDESLRKLVQLHGPRNWSLISRSIP-GRSGKSCRLRWCNQ 54
                     79******************************.***********985 PP

2Myb_DNA-binding60.34.1e-1963105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde++++a++++G++ W+tIar ++ gRt++ +k++w++ 
      Gh_D02G2055  63 PFTAEEDEIIIKAHAKFGNK-WATIARLLN-GRTDNAVKNHWNST 105
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.068459IPR017930Myb domain
SuperFamilySSF466891.8E-316102IPR009057Homeodomain-like
SMARTSM007171.5E-15857IPR001005SANT/Myb domain
PfamPF002492.5E-18954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-251062IPR009057Homeodomain-like
CDDcd001672.95E-141153No hitNo description
PROSITE profilePS5129421.93560110IPR017930Myb domain
SMARTSM007172.3E-1660108IPR001005SANT/Myb domain
PfamPF002495.2E-1663105IPR001005SANT/Myb domain
CDDcd001677.57E-1363106No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2363109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDQDIDRVKG PWGPEEDESL RKLVQLHGPR NWSLISRSIP GRSGKSCRLR WCNQLSPEVA  60
HRPFTAEEDE IIIKAHAKFG NKWATIARLL NGRTDNAVKN HWNSTLKRRR SAEDGDSVQE  120
SERRSSKFPR SGSISNPGSP SGSDVSDLGL SVAESTPHSR VSTALTLGRS WSDELVELNN  180
DNSCTDKESG SVAEKHDNGT KTASLGTELL AAMQEMIRKE VRDCMAEFGF HNQCWG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-3981093104MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-3981093104C-Myb DNA-Binding Domain
1mse_C1e-3981093104C-Myb DNA-Binding Domain
1h89_C6e-39810957158MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-39810957158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.32010.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480196.11e-174PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-70MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2PYB51e-174A0A0D2PYB5_G
STRINGPOPTR_0002s12410.17e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.17e-69myb domain protein 73